CAT# | P03031 |
M.F/Formula | C183H288N54O50S2 |
M.W/Mr. | 4108.8 |
Sequence | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P03014 | (Tyr43)-pTH (43-68) (human) | Inquiry | ||
P03022 | pTH (1-31) amide (human) | Inquiry | ||
P03030 | [Asn8, Leu18] Parathyroid Hormone (1-34), human | Inquiry | ||
P03002 | pTH (73-84) (human) | Inquiry | ||
P03044 | [Tyr0]-Hypercalcemia Malignancy Factor (1-40) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...