Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-34), bovine

Others

Parathyroid Hormone (1-34), bovine

[Price Inquiry]
CAT#
P03031
Sequence
AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
M.W/Mr.
4108.8
Molecular Formula
C183H288N54O50S2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.