Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-44), human

Others

Parathyroid Hormone (1-44), human

[Price Inquiry]
CAT#
P03048
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR
M.W/Mr.
5064.0
Molecular Formula
C225H366N68O61S2
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.