Home > Product > Antimicrobial Peptides > Penaeidin-4C

Antimicrobial Peptides

Penaeidin-4C

[Price Inquiry]
CAT#
AF3240
Sequence
YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
Host Chemicals
Atlantic white shrimp, Litopenaeus setiferus (formerly Penaeus setiferus)
Length
47
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: Q963C3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.