Keywords Search Google Search Search

PxCECA1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2051
Sequence	KPFKKLEKVGRNIRNGIIRYNGPAVAVIGQA
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3056	WAMP-1a	Inquiry
AF2242	Ranatuerin-1T	Inquiry
AF787	Kasseptin 1Mc	Inquiry
AF3189	Esculentin-1PLb	Inquiry
AF2831	Sarcotoxin-1D	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

The function of Margatoxin in blocking K+ channels

Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...

Function of palmitoyl tripeptide-38 in skin

Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

The Function of AdTx1 for α1A-adrenoceptor

AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Plutella xylostella
Length	31