Home > Product > Antimicrobial Peptides > PxCECA1

Antimicrobial Peptides

CAT#
AF2051
Sequence
KPFKKLEKVGRNIRNGIIRYNGPAVAVIGQA
Host Chemicals
Plutella xylostella
Length
31
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.