Home > Product > Antimicrobial Peptides > Sa-AFP2

Antimicrobial Peptides

CAT#
AF3270
Sequence
KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
S alba
Length
50
Activity
Fungi,
SwissProt ID
SwissProt ID: P26780
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.