CAT# | AF3236 |
Sequence | SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV |
Activity | Gram+ & Gram-, Fungi, Mammalian cells, |
Host Chemicals | Bovine Bos taurus | Length | 47 | SwissProt ID | SwissProt ID: P06833 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3062 | Defensin-like peptide | Inquiry | ||
AF873 | Temporin-TR3_2 antimicrobial peptide precursor | Inquiry | ||
AF1352 | Meucin-24 | Inquiry | ||
AF3016 | Defense protein 6 | Inquiry | ||
AF3193 | Esculentin-1-OA5 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...