Home > Product > Antimicrobial Peptides > Seminalplasmin

Antimicrobial Peptides

Seminalplasmin

Price Inquiry
CAT#
AF3236
Sequence
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV
Host Chemicals
Bovine Bos taurus
Length
47
Activity
Gram+ & Gram-, Fungi, Mammalian cells,
SwissProt ID
SwissProt ID: P06833

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.