Home > Product > Antimicrobial Peptides > Seminalplasmin

Antimicrobial Peptides

Seminalplasmin

[Price Inquiry]
CAT#
AF3236
Sequence
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV
Host Chemicals
Bovine Bos taurus
Length
47
Activity
Gram+ & Gram-, Fungi, Mammalian cells,
SwissProt ID
SwissProt ID: P06833
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.