Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.
CAT No: 10-101-285
CAS No:197922-42-2
Synonyms/Alias:Teduglutide;Gattex;revestive;197922-42-2;ALX-0600;(Gly2)GLP-2;Gly(2)-GLP-2;UNII-7M19191IKG;Glucagon-like peptide II (2-glycine) (human);ALX 0600;GLP2-2G;HSDB 8337;7M19191IKG;HGDGSFSDEMNTILDNLAARDFINWLIQTKITD;287714-30-1;[Gly2]GLP-2;His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp;teduglutidum;Teduglutide [USAN:INN:BAN];Teduglutide?;TEDUGLUTIDE (MART.);GTPL7049;SCHEMBL20898050;A16AX08;Glucagon-like Peptide II (2-glycine);DA-58382;[2-Glycine]glucagon-like peptide II (human);2-GLYCINE-1-33-GLUCAGON-LIKE PEPTIDE II (HUMAN);ALX 0600 (2-GLYCINE-1-33-GLUCAGON-LIKE PEPTIDE II (HUMAN));
Teduglutide is a synthetic peptide analog of human glucagon-like peptide-2 (GLP-2), designed to mimic the biological activity of the endogenous intestinal hormone. Structurally characterized by its enhanced resistance to enzymatic degradation, Teduglutide demonstrates prolonged activity in modulating gastrointestinal physiology. Its primary mechanism of action involves binding to the GLP-2 receptor, stimulating a cascade of intracellular events that promote intestinal growth and repair. Due to these attributes, Teduglutide has become a valuable tool in peptide research, especially in studies focused on gut mucosal biology, peptide-receptor interactions, and gastrointestinal regenerative processes. The compound's stability and bioactivity make it particularly suitable for advanced research applications in both academic and industrial settings.
Peptide-receptor interaction studies: Teduglutide serves as a robust model compound for investigating GLP-2 receptor dynamics and downstream signaling pathways. Researchers utilize it to elucidate the molecular mechanisms governing receptor activation, signal transduction, and the modulation of cellular responses in intestinal epithelial cells. Its well-characterized structure-function relationship provides a reliable foundation for dissecting the nuances of peptide-receptor engagement, making it a preferred choice for in vitro binding assays and receptor pharmacology experiments.
Intestinal growth and regeneration research: The ability of Teduglutide to stimulate intestinal epithelial proliferation and enhance mucosal repair is exploited in experimental models of gut injury and adaptation. Scientists employ the peptide to investigate the cellular and molecular basis of intestinal regeneration, focusing on crypt cell proliferation, villus height modulation, and barrier function restoration. These studies are instrumental in advancing the understanding of gastrointestinal tissue homeostasis and the regenerative potential of GLP-2 analogs under various physiological and pathophysiological conditions.
Peptide stability and degradation analysis: As a synthetic analog engineered for resistance to dipeptidyl peptidase IV (DPP-IV) degradation, Teduglutide is frequently used in comparative studies assessing peptide half-life, metabolic stability, and proteolytic susceptibility. These investigations inform the rational design of novel peptide therapeutics by highlighting structural modifications that enhance bioavailability and functional persistence. Analytical techniques such as mass spectrometry and high-performance liquid chromatography are commonly applied to monitor its metabolic fate and degradation kinetics.
Intestinal nutrient absorption studies: Teduglutide's role in modulating intestinal absorptive capacity makes it a valuable reagent in research exploring nutrient transport mechanisms. By augmenting mucosal surface area and functional transporter expression, the peptide enables detailed assessment of macronutrient uptake, electrolyte balance, and fluid absorption in various experimental systems. Applications in this domain contribute to a deeper understanding of intestinal adaptation processes in response to luminal stimuli or surgical interventions.
Peptide formulation and delivery research: The unique pharmacokinetic properties of Teduglutide provide a model system for evaluating peptide formulation strategies and delivery technologies. Researchers utilize it to test the efficacy of novel carrier systems, sustained-release matrices, and targeted delivery approaches aimed at optimizing peptide stability and bioactivity. These studies support the development of innovative solutions for enhancing the therapeutic potential and translational applicability of peptide-based agents in gastrointestinal research.
3. Cationic cell-penetrating peptides are potent furin inhibitors
4. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.
Read More