Home > Product > Antimicrobial Peptides > Beta-defensin133

Antimicrobial Peptides

Beta-defensin133

[Price Inquiry]
CAT#
AF2695
Sequence
AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM
Host Chemicals
Homo sapiens
Length
38
Activity
Antibacterial
SwissProt ID
Q30KQ1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.