Home > Product > Antimicrobial Peptides > Cathelicidin-related antimicrobial peptide

Antimicrobial Peptides

Cathelicidin-related antimicrobial peptide

[Price Inquiry]
CAT#
AF2925
Sequence
AKRGGFWRKVGRKLGKGIRKIGKTIKSQLGKFRPRLQYRYQF
Host Chemicals
Chinchilla lanigera
Length
42
Activity
Antibacterial
SwissProt ID
Q0R5P1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.