Home > Product > Antimicrobial Peptides > Cycloviolacin O19

Antimicrobial Peptides

Cycloviolacin O19

[Price Inquiry]
CAT#
AF2040
Sequence
GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
Host Chemicals
Viola odorata
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.