Home > Product > Antimicrobial Peptides > Dermaseptin-3

Antimicrobial Peptides

Dermaseptin-3

[Price Inquiry]
CAT#
AF2336
Sequence
ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS
Host Chemicals
Phyllomedusa hypochondrialis
Length
34
Activity
Antimicrobial
SwissProt ID
P84598
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.