Home > Product > Antimicrobial Peptides > Enterocin X beta

Antimicrobial Peptides

Enterocin X beta

[Price Inquiry]
CAT#
AF2642
Sequence
IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK
Host Chemicals
Enterococcus faecium KU-B5
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.