Home > Product > Catalog Peptides > Others > Glicentin-Related Peptide (21-50), human

Others

Glicentin-Related Peptide (21-50), human

[Price Inquiry]
CAT#
E10011
Sequence
RSLQDTEEKSRSFSASQADPLSDPDQMNED-NH2
M.W/Mr.
3383.5
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.