Home > Product > Catalog Peptides > Exendins and Fragments > Exendin (4-39)

Exendins and Fragments

Exendin (4-39)

[Price Inquiry]
CAT#
E10008
Sequence
GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3863.3
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.