Home > Product > Catalog Peptides > Exendins and Fragments > Des His1, Glu8 Exendin-4

Exendins and Fragments

Des His1, Glu8 Exendin-4

[Price Inquiry]
CAT#
E10004
Sequence
GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
4063.6
Molecular Formula
C179H277N47O59S1
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.