Home > Product > Catalog Peptides > Exendins and Fragments > Exendin (7-39)

Exendins and Fragments

Exendin (7-39)

[Price Inquiry]
CAT#
E10010
Sequence
TSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSNH3
M.W/Mr.
3558.0
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.