Home > Product > Catalog Peptides > Exendins and Fragments > Exendin (10-39)

Exendins and Fragments

Exendin (10-39)

[Price Inquiry]
CAT#
E10007
Sequence
LSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3254.7
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.