Home > Product > Catalog Peptides > Exendins and Fragments > [Des-His1, Glu8]-Exendin-4

Exendins and Fragments

[Des-His1, Glu8]-Exendin-4

[Price Inquiry]
CAT#
E10006
Sequence
GEGTPTSELSKQMEEEAVRLPIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3963.4
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.