Home > Product > Catalog Peptides > Others > Exendin (5-39)

Others

warning All products are for research use only. Not for human use.

Exendin (5-39)

[Price Inquiry]
CAT#
E10009
Sequence
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3806.3
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.