Home > Product > Catalog Peptides > Exendins and Fragments > Exendin-4 (3-39)

Exendins and Fragments

Exendin-4 (3-39)

Price Inquiry
CAT#
E10005
Sequence
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
3991.5
Molecular Formula
C176H271N46O58S1
Length
37

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.