Home > Product > Catalog Peptides > Others > Growth Hormone Releasing Factor, GRF (1 - 44), amide, human

Others

Growth Hormone Releasing Factor, GRF (1 - 44), amide, human

Price Inquiry
CAT#
G09008
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARA
M.W/Mr.
5039.7
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.