Growth Hormone Releasing Factor, GRF (1 - 44), amide, human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	G09008
M.W/Mr.	5039.7
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARA

CAT#	Product Name	Inquiry
G09010	GRF (porcine)	Inquiry
G09006	GRF (1-40), human	Inquiry
G09013	GRF (rat)	Inquiry
G09017	(Nle27)-GRF (1-29) amide (human)	Inquiry
G09016	(D-Ala2)-GRF (1-29) amide (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of linaclotide in irritable bowel syndrome

Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: