CAT# | AF2573 |
Sequence | GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN |
Activity | Antiviral |
Host Chemicals | Palicourea condensata | Length | 37 | SwissProt ID | P84645 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF692 | Phylloseptin-J5 | Inquiry | ||
AF3294 | So-D2 | Inquiry | ||
AF2679 | Arasin 2 | Inquiry | ||
AF3122 | Temporin-MT3 antimicrobial peptide precursor | Inquiry | ||
AF421 | Calcitermin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...