Home > Product > Antimicrobial Peptides > Palicourein

Antimicrobial Peptides

Palicourein

[Price Inquiry]
CAT#
AF2573
Sequence
GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
Host Chemicals
Palicourea condensata
Length
37
Activity
Antiviral
SwissProt ID
P84645
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.