Home > Product > Antimicrobial Peptides > Temporin-MT3 antimicrobial peptide precursor

Antimicrobial Peptides

Temporin-MT3 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3122
Sequence
TMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR
Host Chemicals
Amolops mantzorum
Length
44
Activity
Antimicrobial
SwissProt ID
E1AXG2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.