Home > Product > Catalog Peptides > Others > protease inhibitor PI-5

Others

warning All products are for research use only. Not for human use.

protease inhibitor PI-5

[Price Inquiry]
CAT#
P15014
Sequence
QVNCTPGTTFQDRCNTCRCSSNGRSAACTLKACPGFG
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.