Home > Product > Antimicrobial Peptides > RhBD-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2486
Sequence
DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK
Host Chemicals
Macaca mulatta
Length
36
Activity
Antibacterial
SwissProt ID
O18794
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.