Home > Product > Antimicrobial Peptides > SBD-1

Antimicrobial Peptides

CAT#
AF2744
Sequence
NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
Host Chemicals
Ovis aries
Length
38
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.