Keywords Search Google Search Search

Sushi peptide 1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2347
Sequence	GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS
Activity	Gram-,

CAT#	Product Name	Inquiry
AF1094	Galensin	Inquiry
AF3163	Antimicrobial peptide defensin 3	Inquiry
AF329	Eumenine mastoparan-OD	Inquiry
AF3081	Piscidin 4	Inquiry
AF1914	Cliotide T1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

Function of lepirudin in heparin-induced thrombocytopenia

Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

Function of peginesatide in anemia

Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...

Brief information of insulin

Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...

PBP 10, a highly specific FPR2 antagonist

PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Protein-derived peptide
Length	34