Home > Product > Catalog Peptides > Others > Gastric Inhibitory Peptide (GIP), human

Others

warning All products are for research use only. Not for human use.

Gastric Inhibitory Peptide (GIP), human

[Price Inquiry]
CAT#
G02009
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
M.W/Mr.
4983.6
Molecular Formula
C226H338N60O66S1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.