Keywords Search Google Search Search

mCRAMP

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2357
Sequence	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Activity	Gram+ & Gram-,

CAT#	Product Name	Inquiry
AF2893	Hepcidin-like antimicrobial peptide precursor	Inquiry
AF3018	Enterocin L50B	Inquiry
AF1558	Lactoferricin	Inquiry
AF2597	Esculentin-2Rb	Inquiry
AF038	Cr-ACP1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

MEN 11270, a peptide antagonist at the human B2 kinin receptor

MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Mouse, Mus musculus
Length	34
SwissProt ID	SwissProt ID: P51473