Home > Product > Antimicrobial Peptides > mCRAMP

Antimicrobial Peptides

CAT#
AF2357
Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Host Chemicals
Mouse, Mus musculus
Length
34
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P51473

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.