Home > Product > Antimicrobial Peptides > mCRAMP

Antimicrobial Peptides

CAT#
AF2357
Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Host Chemicals
Mouse, Mus musculus
Length
34
Activity
Gram+ & Gram-,
SwissProt ID
SwissProt ID: P51473
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.