Home > Product > Catalog Peptides > Others > Growth Hormone Releasing Factor, GRF (1 - 40), amide, human

Others

warning All products are for research use only. Not for human use.

Growth Hormone Releasing Factor, GRF (1 - 40), amide, human

[Price Inquiry]
CAT#
G09005
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2
M.W/Mr.
4543.1
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.