Keywords Search Google Search Search

HFIAP-3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1951
Sequence	GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF2014	Ranatuerin-2Ca	Inquiry
AF2262	Preprochensinin-1CEc	Inquiry
AF1933	Cycloviolacin O24	Inquiry
AF415	Amaryllin	Inquiry
AF780	Dybowskin-6	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Function of DAMME in analgesia

DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

PAC-113: A clinically active antimicrobial peptide

PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Myxine glutinosa
Length	30