Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
CAT# | 10-101-285 |
Chemical Structure | |
CAS | 197922-42-2 |
Synonyms/Alias | Gattex; Glucagon-like peptide II [2-glycine] (human); ALX 0600 |
M.F/Formula | C164H252N44O55S |
M.W/Mr. | 3752.08 |
Sequence | One Letter Code: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Three Letter Code: H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
Application | Teduglutide is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. |
Appearance | White or off-white lyophilized powder |
Purity | 0.98 |
Biological Activity | Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models. |
Areas of Interest | Short bowel syndrome |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...