Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
CAT# | 10-101-285 |
Chemical Structure | ![]() |
CAS | 197922-42-2 |
Synonyms/Alias | Gattex; Glucagon-like peptide II [2-glycine] (human); ALX 0600 |
M.F/Formula | C164H252N44O55S |
M.W/Mr. | 3752.08 |
Sequence | One Letter Code: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Three Letter Code: H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
Application | Teduglutide is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. |
Appearance | White or off-white lyophilized powder |
Purity | 0.98 |
Biological Activity | Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models. |
Areas of Interest | Short bowel syndrome |
Source# | Synthetic | Storage | Store at -20°C. | Shipping Condition | Room temperature | InChI Key | CILIXQOJUNDIDU-ASQIGDHWSA-N | Canonical SMILES | CCC(C)C(C(=O)NC(C(C)O)C(=O)NC(CC(=O)O)C(=O)O)NC(=O)C(CCCCN)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC(C)C)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(CC(=O)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C(CC(C)C)NC(=O)C(C(C)CC)NC(=O)C(C(C)O)NC(=O)C(CC(=O)N)NC(=O)C(CCSC)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC4=CC=CC=C4)NC(=O)C(CO)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)CNC(=O)C(CC5=CN=CN5)N |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
HB00131 | Octadecanedioic acid mono(1,1-dimethylethyl) ester | Inquiry | ||
10-101-40 | Ornipressin | Inquiry | ||
10-101-303 | GPLGIAGQ | Inquiry | ||
HB00083 | TAT peptide | Inquiry | ||
HB00112 | Thymalfasin | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).