Teduglutide

CAT#	10-101-285
Chemical Structure
CAS	197922-42-2
Synonyms/Alias	Gattex; Glucagon-like peptide II [2-glycine] (human); ALX 0600
M.F/Formula	C164H252N44O55S
M.W/Mr.	3752.08
Sequence	One Letter Code: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Three Letter Code: H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Application	Teduglutide is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion.
Appearance	White or off-white lyophilized powder
Purity	0.98
Biological Activity	Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models.
Areas of Interest	Short bowel syndrome

Source#	Synthetic
Storage	Store at -20°C.
Shipping Condition	Room temperature
InChI Key	CILIXQOJUNDIDU-ASQIGDHWSA-N
Canonical SMILES	CCC(C)C(C(=O)NC(C(C)O)C(=O)NC(CC(=O)O)C(=O)O)NC(=O)C(CCCCN)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC(C)C)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(CC(=O)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C(CC(C)C)NC(=O)C(C(C)CC)NC(=O)C(C(C)O)NC(=O)C(CC(=O)N)NC(=O)C(CCSC)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC4=CC=CC=C4)NC(=O)C(CO)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)CNC(=O)C(CC5=CN=CN5)N

CAT#	Product Name	M.W	Molecular Formula	Inquiry
HB00131	Octadecanedioic acid mono(1,1-dimethylethyl) ester			Inquiry
10-101-40	Ornipressin			Inquiry
10-101-303	GPLGIAGQ			Inquiry
HB00083	TAT peptide			Inquiry
HB00112	Thymalfasin			Inquiry

1. Relatedness of antibodies to peptides containing homocitrulline or citrulline in patients with rheumatoid arthritis

2. Crystal Structure of BamB from Pseudomonas aeruginosa and Functional Evaluation of Its Conserved Structural Features

3. P-selectin and Complement’s Role in a Neonatal Model of Germinal Matrix Hemorrhage-Induced Secondary Injury

4. An interdomain binding site on HIV-1 Nef interacts with PACS-1 and PACS-2 on endosomes to down-regulate MHC-I

5. GLP-1, exendin-4 and C-peptide regulate pancreatic islet microcirculation, insulin secretion and glucose tolerance in rats