Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Teduglutide(CAS 197922-42-2)

CAT No: 10-101-285

CAS No:197922-42-2

Synonyms/Alias:Teduglutide;Gattex;revestive;197922-42-2;ALX-0600;(Gly2)GLP-2;Gly(2)-GLP-2;UNII-7M19191IKG;Glucagon-like peptide II (2-glycine) (human);ALX 0600;GLP2-2G;HSDB 8337;7M19191IKG;HGDGSFSDEMNTILDNLAARDFINWLIQTKITD;287714-30-1;[Gly2]GLP-2;His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp;teduglutidum;Teduglutide [USAN:INN:BAN];Teduglutide?;TEDUGLUTIDE (MART.);GTPL7049;SCHEMBL20898050;A16AX08;Glucagon-like Peptide II (2-glycine);DA-58382;[2-Glycine]glucagon-like peptide II (human);2-GLYCINE-1-33-GLUCAGON-LIKE PEPTIDE II (HUMAN);ALX 0600 (2-GLYCINE-1-33-GLUCAGON-LIKE PEPTIDE II (HUMAN));

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C164H252N44O55S
M.W/Mr.
3752.1
Sequence
One Letter Code:HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Three Letter Code:H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Application
Teduglutide is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion.
Appearance
White or off-white lyophilized powder
Purity
0.98
Biological Activity
Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models.
Areas of Interest
Short bowel syndrome

Teduglutide, a synthetic analog of human glucagon-like peptide-2 (GLP-2), is an advanced peptide compound recognized for its ability to enhance intestinal function and integrity. Engineered to resist enzymatic degradation, Teduglutide demonstrates a prolonged half-life compared to endogenous GLP-2, making it highly valuable for research focused on gastrointestinal physiology and peptide-based signaling. Its molecular structure closely mimics natural GLP-2, allowing it to interact efficiently with the GLP-2 receptor and stimulate downstream biological pathways involved in mucosal growth and nutrient absorption. Due to these unique biochemical features, Teduglutide has emerged as an indispensable tool in a variety of scientific investigations related to gut health, nutrient assimilation, and epithelial repair.

Intestinal Research Models: Teduglutide is widely utilized in preclinical studies designed to explore the mechanisms of intestinal adaptation and repair. By activating GLP-2 receptors on enterocytes and subepithelial myofibroblasts, it promotes crypt cell proliferation and reduces apoptosis, thereby supporting mucosal regeneration. Research teams often employ this peptide in animal models of intestinal injury or resection to investigate its capacity for enhancing villus height and improving absorptive surface area. These studies contribute to a deeper understanding of how gut peptides can be harnessed to mitigate malabsorption and facilitate recovery following gastrointestinal trauma or surgery.

Nutrient Absorption Studies: In the context of nutrient assimilation research, Teduglutide serves as a powerful agent for dissecting the regulation of intestinal transporters and digestive enzyme expression. Experimental protocols frequently incorporate this GLP-2 analog to assess its impact on the absorption of macronutrients such as carbohydrates, proteins, and lipids. By stimulating the proliferation of absorptive enterocytes and modulating the expression of nutrient transporters, it enables researchers to quantify changes in uptake efficiency and better characterize the molecular determinants of gut barrier function. Such studies are crucial for identifying potential therapeutic targets in conditions characterized by impaired nutrient absorption.

Epithelial Barrier Function: The role of Teduglutide in maintaining and restoring epithelial barrier integrity is another prominent area of investigation. Scientists leverage its ability to enhance tight junction protein expression and reduce intestinal permeability in models of barrier dysfunction. By mitigating the translocation of luminal antigens and pathogens, the peptide helps elucidate the pathways involved in mucosal defense and immune modulation. These insights are especially relevant for research into gastrointestinal disorders where barrier breakdown plays a central role in disease progression.

Enteric Nervous System and Motility: Teduglutide is also employed in studies examining the interplay between the gut epithelium and the enteric nervous system. Its effects on neuroendocrine signaling and intestinal motility are explored to understand how GLP-2 receptor activation influences peristalsis, secretion, and overall digestive homeostasis. By modulating neurotransmitter release and smooth muscle contractility, the peptide provides a valuable model for investigating the neuroregulatory aspects of gastrointestinal function and their implications for disorders such as dysmotility and irritable bowel syndrome.

Tissue Engineering and Regenerative Medicine: In the field of tissue engineering, Teduglutide is increasingly incorporated into bioengineering platforms aimed at developing functional intestinal grafts or organoids. Its trophic effects on epithelial and submucosal cell populations facilitate the growth and differentiation of engineered tissues, supporting efforts to create physiologically relevant models for transplantation and drug testing. Researchers utilize its capacity to stimulate angiogenesis and cellular proliferation to optimize the structural and functional properties of engineered gut constructs, advancing the development of innovative solutions for intestinal regeneration and repair.

Source#
Synthetic
Shipping Condition
Room temperature
InChI
InChI=1S/C164H252N44O55S/c1-21-77(11)126(156(255)187-95(44-46-114(167)214)141(240)206-130(83(17)211)160(259)186-93(42-33-34-49-165)140(239)202-129(80(14)24-4)159(258)208-131(84(18)212)161(260)200-111(163(262)263)66-125(230)231)203-151(250)100(54-76(9)10)189-145(244)103(57-88-67-175-92-41-32-31-40-90(88)92)192-147(246)105(60-116(169)216)199-157(256)127(78(12)22-2)204-152(251)102(56-87-38-29-26-30-39-87)190-149(248)109(64-123(226)227)195-137(236)94(43-35-50-174-164(171)172)183-134(233)82(16)179-133(232)81(15)180-142(241)98(52-74(5)6)188-146(245)104(59-115(168)215)194-150(249)110(65-124(228)229)196-143(242)99(53-75(7)8)198-158(257)128(79(13)23-3)205-162(261)132(85(19)213)207-153(252)106(61-117(170)217)193-139(238)97(48-51-264-20)185-138(237)96(45-47-120(220)221)184-148(247)108(63-122(224)225)197-155(254)113(72-210)201-144(243)101(55-86-36-27-25-28-37-86)191-154(253)112(71-209)182-119(219)70-177-136(235)107(62-121(222)223)181-118(218)69-176-135(234)91(166)58-89-68-173-73-178-89/h25-32,36-41,67-68,73-85,91,93-113,126-132,175,209-213H,21-24,33-35,42-66,69-72,165-166H2,1-20H3,(H2,167,214)(H2,168,215)(H2,169,216)(H2,170,217)(H,173,178)(H,176,234)(H,177,235)(H,179,232)(H,180,241)(H,181,218)(H,182,219)(H,183,233)(H,184,247)(H,185,237)(H,186,259)(H,187,255)(H,188,245)(H,189,244)(H,190,248)(H,191,253)(H,192,246)(H,193,238)(H,194,249)(H,195,236)(H,196,242)(H,197,254)(H,198,257)(H,199,256)(H,200,260)(H,201,243)(H,202,239)(H,203,250)(H,204,251)(H,205,261)(H,206,240)(H,207,252)(H,208,258)(H,220,221)(H,222,223)(H,224,225)(H,226,227)(H,228,229)(H,230,231)(H,262,263)(H4,171,172,174)/t77-,78-,79-,80-,81-,82-,83+,84+,85+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,126-,127-,128-,129-,130-,131-,132-/m0/s1
InChI Key
CILIXQOJUNDIDU-ASQIGDHWSA-N
Canonical SMILES
CCC(C)C(C(=O)NC(C(C)O)C(=O)NC(CC(=O)O)C(=O)O)NC(=O)C(CCCCN)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC(C)C)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(CC(=O)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C(CC(C)C)NC(=O)C(C(C)CC)NC(=O)C(C(C)O)NC(=O)C(CC(=O)N)NC(=O)C(CCSC)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC4=CC=CC=C4)NC(=O)C(CO)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)CNC(=O)C(CC5=CN=CN5)N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers