Keywords Search Google Search Search

Beta-defensin126

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3022
Sequence	NWYVKKCLNDVGICKKKCKPEELHVKNGRAMCGKQRDCCVPAD
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3249	Cathelicidin-AL	Inquiry
AF1095	Antibacterial peptide/melittin homolog	Inquiry
AF1795	Vibi B	Inquiry
AF136	OdVP2	Inquiry
AF2921	Antimicrobial peptide, Lci	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Tripeptide-10 Citrulline, a substitute of decorin

An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Function of porcine secretin on cannulation of the dorsal pancreatic duct at ERCP in patients with pancreas divisum

Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...

Liraglutide for type 2 diabetes and weight loss

Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...

Function of ACV 1 As A Highly Selective Antagonist

Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Hylobates lar
Length	43
SwissProt ID	A4H245