Products
Home > Functional Peptides > Antimicrobial Peptides > Cryptdin related sequence peptide

If you find Creative Peptides is useful to satisfy your needs, please do not hesitate to contact us!

Cryptdin related sequence peptide

CAT#
AF2738
Sequence
LQDAAVGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
Host Chemicals
Mus musculus
Length
38
Activity
Antimicrobial
SwissProt ID
Q70LV9

Useful Tools

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry
  • Please enter the code "peptides"

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

Follow us on:

Copyright © 2008 - Creative Peptides. All rights reserved.

USA

Address: 45-16 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

E-Mail:

Europe

Tel: 44-207-097-1828

E-Mail: