Cecropin B is an antibacterial peptide isolated from pig intestine and moths. This peptide inhibits proline uptake in bacteria by lysing cell membranes and making them leaky.
CAT# | R1863 |
CAS | 80451-05-4 |
M.F/Formula | C176H302N52O41S |
M.W/Mr. | 3835 |
Sequence | One Letter Code: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Three Letter Code: H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
Purity | ≥97% (HPLC) |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...