GLP-1(7-37)
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Online Inquiry
| CAT# | R1382 |
| Chemical Structure |  |
| CAS | 106612-94-6 |
| Synonyms/Alias | Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat), Insulinotropin (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat) |
| M.F/Formula | C151H228N40O47 |
| M.W/Mr. | 3355.67 |
| Sequence | One Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Biological Activity | Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone. |
| Storage | Desiccate at -20°C |
Solubility | H2O : 30 mg/mL (8.94 mM; Need ultrasonic and warming) |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for GLP-1(7-37)
Required fields are marked with *
×
Ask a Question for GLP-1(7-37)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
