Brain Natriuretic Peptide (BNP) (1-32), rat

Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Brain Natriuretic Peptide (BNP) (1-32), rat(CAS 133448-20-1)

CAT No: R1251

CAS No:133448-20-1

Synonyms/Alias:Brain Natriuretic Peptide-32 rat;133448-20-1;DTXSID50745570;PUBCHEM_71308564;BNP-32 (rat) trifluoroacetate salt;DA-51271;14-45-Brain natriureticpeptide-45(rat)(9ci);Brain Natriuretic Peptide-32 rat, >=97% (HPLC), powder;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C146H239N47O44S3
M.W/Mr.
3453
Sequence
One Letter Code:NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Three Letter Code:H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys(1)-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys(1)-Asp-Gly-Leu-Arg-Leu-Phe-OH

Brain Natriuretic Peptide (BNP) (1-32), rat, is a synthetic peptide corresponding to the biologically active form of BNP found in rat species. As a member of the natriuretic peptide family, BNP plays a pivotal role in cardiovascular homeostasis, particularly in modulating blood pressure, vascular tone, and fluid balance through its action on natriuretic peptide receptors. Its sequence and function are highly conserved, making it a critical molecular tool for researchers investigating peptide-mediated signaling, cardiovascular physiology, and related biochemical pathways in rodent models. The availability of the full-length, bioactive form enables precise studies of receptor interactions, downstream signaling cascades, and cross-species physiological comparisons.

Receptor pharmacology: Researchers utilize BNP (1-32), rat, to investigate the pharmacodynamics and pharmacokinetics of natriuretic peptide receptors, especially NPR-A and NPR-B, in preclinical models. By applying this peptide in in vitro and ex vivo systems, scientists can characterize receptor binding affinities, activation profiles, and downstream cyclic GMP signaling. Such studies are fundamental for elucidating the molecular basis of natriuretic peptide function and for screening novel modulators or antagonists of natriuretic peptide pathways.

Cardiovascular physiology research: In the context of cardiovascular biology, BNP (1-32) serves as an essential probe for dissecting the mechanisms underlying cardiac load, hypertrophy, and remodeling in rat models. Application of the peptide in isolated heart preparations, vascular tissue assays, or whole-animal experiments allows for the assessment of its direct effects on myocardial contractility, vascular relaxation, and fluid-electrolyte regulation. These studies help clarify the physiological roles of endogenous natriuretic peptides and inform the development of new strategies for managing cardiovascular dysfunction in experimental systems.

Signal transduction studies: The peptide is widely employed in cellular and molecular investigations focused on natriuretic peptide receptor-mediated signaling. By introducing BNP (1-32) into cultured cells or tissue explants, researchers can monitor the activation of guanylyl cyclase, production of cyclic GMP, and modulation of downstream effectors such as protein kinases and ion channels. These experiments provide detailed insights into the mechanisms by which natriuretic peptides influence cell signaling networks, gene expression, and functional outcomes in cardiac and vascular tissues.

Peptide structure-function analysis: BNP (1-32), rat, offers a valuable template for structure-activity relationship (SAR) studies and peptide engineering. By comparing the activity of the native sequence with that of analogs or truncated variants, scientists can identify critical residues responsible for receptor specificity, stability, and biological potency. Such analyses support the rational design of novel natriuretic peptide mimetics or antagonists with tailored functional properties for use in research applications.

Comparative physiology and translational research: The rat-specific sequence of BNP (1-32) enables precise modeling of natriuretic peptide biology in rodent systems, facilitating cross-species comparisons with human and other mammalian forms. Researchers leverage this peptide to investigate evolutionary conservation, species-specific receptor interactions, and differences in physiological responses. These comparative studies are essential for validating experimental models and translating preclinical findings to broader biological contexts.

Overall, BNP (1-32), rat, is a versatile and scientifically robust tool for advancing research in peptide pharmacology, cardiovascular physiology, cell signaling, and molecular engineering. Its targeted applications underpin a wide array of experimental approaches across basic, translational, and applied biochemical research domains.

Source#
Synthetic
InChI
InChI=1S/C146H239N47O44S3/c1-16-75(11)114-140(233)165-59-107(201)167-77(13)117(210)191-113(74(9)10)141(234)189-102(67-198)134(227)176-86(38-29-46-160-145(154)155)124(217)179-90(49-71(3)4)119(212)162-62-110(204)171-103(138(231)182-95(56-111(205)206)121(214)164-61-109(203)170-91(50-72(5)6)129(222)173-85(37-28-45-159-144(152)153)125(218)180-92(51-73(7)8)130(223)184-97(143(236)237)53-80-33-22-19-23-34-80)68-239-240-69-104(139(232)181-93(52-79-31-20-18-21-32-79)120(213)163-60-108(202)169-88(40-41-105(150)199)126(219)172-84(36-25-27-44-148)127(220)193-115(76(12)17-2)142(235)183-96(57-112(207)208)132(225)174-87(128(221)192-114)39-30-47-161-146(156)157)190-137(230)101(66-197)188-136(229)100(65-196)187-135(228)99(64-195)186-131(224)94(54-81-58-158-70-166-81)178-116(209)78(14)168-122(215)89(42-48-238-15)177-123(216)83(35-24-26-43-147)175-133(226)98(63-194)185-118(211)82(149)55-106(151)200/h18-23,31-34,58,70-78,82-104,113-115,194-198H,16-17,24-30,35-57,59-69,147-149H2,1-15H3,(H2,150,199)(H2,151,200)(H,158,166)(H,162,212)(H,163,213)(H,164,214)(H,165,233)(H,167,201)(H,168,215)(H,169,202)(H,170,203)(H,171,204)(H,172,219)(H,173,222)(H,174,225)(H,175,226)(H,176,227)(H,177,216)(H,178,209)(H,179,217)(H,180,218)(H,181,232)(H,182,231)(H,183,235)(H,184,223)(H,185,211)(H,186,224)(H,187,228)(H,188,229)(H,189,234)(H,190,230)(H,191,210)(H,192,221)(H,193,220)(H,205,206)(H,207,208)(H,236,237)(H4,152,153,159)(H4,154,155,160)(H4,156,157,161)/t75-,76-,77-,78-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,113-,114-,115-/m0/s1
InChI Key
CKSKSHHAEYGHSB-LBCJMRPYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide CDMOEpitope Mapping ServicesPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers