Brain Natriuretic Peptide (BNP) (1-32), rat
Brain Natriuretic Peptide (BNP) (1-32), rat
Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
Online Inquiry
| CAT# | R1251 |
| CAS | 133448-20-1 |
| Synonyms/Alias | Brain Natriuretic Peptide-32 (rat) |
| M.F/Formula | C₁₄₆H₂₃₉N₄₇O₄₄S₃ |
| M.W/Mr. | 3452.94 |
| Sequence | One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
three Letter Code: Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Brain Natriuretic Peptide (BNP) (1-32), rat
Required fields are marked with *
×
Ask a Question for Brain Natriuretic Peptide (BNP) (1-32), rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
