Prepro-Atrial Natriuretic Factor (26-55) (human)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A17053
CAS	112160-82-4
M.F/Formula	C₁₅₂H₂₃₆N₃₈O₅₁S₃
M.W/Mr.	3507.97
Sequence	One Letter Code: NPMYNAVSNADLMDFKNLLDHLEEKMPLED three Letter Code: H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH

CAT#	Product Name	Inquiry
A17028	Atrial Natriuretic Peptide (ANP)(1-28) Alpha (Human, Ovine, Canine)	Inquiry
A17026	Atrial Natriuretic Peptide (3-28), human	Inquiry
A17045	Atrial Natriuretic Factor (3-28) (human, bovine, porcine) trifluoroacetate salt	Inquiry
A17009	Anantin	Inquiry
A17013	Atrial Natriuretic Peptide (4-24), frog	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

UT receptor peptide antagonist-UFP 803

UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...

The application of obestatin (human) in hormonal therapy

Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Length	30
Storage	-20 ± 5 °C