Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.
CAT# | R1626 |
CAS | 111366-38-2 |
M.F/Formula | C₂₀₂H₃₂₅N₅₃O₆₄S |
M.W/Mr. | 4552.13 |
Sequence | One Letter Code: HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV three Letter Code: His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...