Home > Product > Catalog Peptides > Others > Leptin (138-167) (human)

Others

Leptin (138-167) (human)

Price Inquiry
CAT#
L03007
Sequence
SGYSTEVVALSRLQGSLQDMLWQLDLSPGC
M.W/Mr.
3253.68
Molecular Formula
C141H224N37O47S2
Length
30

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.