CAT# | AF3059 |
Sequence | ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR |
Activity | Antibacterial |
Host Chemicals | Enterococcus hirae | Length | 44 | SwissProt ID | Q0Z8B6 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3205 | Viscotoxin B | Inquiry | ||
AF1064 | BacCH91 | Inquiry | ||
AF2468 | Beta-defensin-1 | Inquiry | ||
AF2976 | Seed non-specific lipid transfer protein-like | Inquiry | ||
AF3101 | MR10 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...