Keywords Search Google Search Search

[Gln22]-beta-Amyloid (6-40)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13227
M.W/Mr.	3710.2
Sequence	HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13198	Beta-Amyloid (11-40), mouse, rat	Inquiry
A13110	Beta-Amyloid (1-16), mouse, rat	Inquiry
A13114	Beta-Amyloid (3-17)	Inquiry
A13049	Beta-Amyloid (22-35)	Inquiry
A13283	[Arg22] b-Amyloid (1-40)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

β-secretase and γ-Secretase Inhibitors

Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: