Keywords Search Google Search Search

AGRP fragment (83-132), amide

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A06007
M.W/Mr.	5687.7
Sequence	SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGT

CAT#	Product Name	Inquiry
A06006	AGRP (87-132), human	Inquiry
A06003	Agouti-related Protein (AGRP) (25-82), human	Inquiry
A06002	Agouti-related Protein (AGRP) [Tyr0] (54-82), human	Inquiry
A06004	AGRP (25-51)	Inquiry
A06001	Agouti-related Protein (AGRP) [Tyr0] (25-51) , human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of ACV 1 As A Highly Selective Antagonist

Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...

What Is Anisomycin?

Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Function of acetyl glutamyl heptapeptide-3 in skin

Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: