Home > Product > Catalog Peptides > Others > AGRP fragment (83-132), amide

Others

AGRP fragment (83-132), amide

Price Inquiry
CAT#
A06007
Sequence
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGT
M.W/Mr.
5687.7
Length
42

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.