Keywords Search Google Search Search

Bacteriocin curvacin-A

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2866
Sequence	ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF788	Alpha-basrubrin	Inquiry
AF1694	Ranatuerin-2Vb	Inquiry
AF1249	Brevinin-1Be	Inquiry
AF2353	Corticostatin 1	Inquiry
AF1358	Antimicrobial peptide scolopin-2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Novel Peptide Drugs to Treat Multiple Diseases (Part Two)

5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...

Function of a vasoactive peptide Endothelin-1

Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...

Cyclotraxin B, A Selective Antagonist of TrkB Receptors

Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...

Function of myristoyl pentapeptide-7 in skin and eyelash

Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Lactobacillus curvatus
Length	41
SwissProt ID	P0A311