CAT# | AF2866 |
Sequence | ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM |
Activity | Antibacterial |
Host Chemicals | Lactobacillus curvatus | Length | 41 | SwissProt ID | P0A311 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1620 | Maximin 15 | Inquiry | ||
AF513 | Jingdongin-1 antimicrobial peptide precursor | Inquiry | ||
AF550 | Brevinin-1Da | Inquiry | ||
AF2155 | Defensin-A2 | Inquiry | ||
AF1400 | Human Histatin 6 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...