Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C150H217N43O48 |
M.W/Mr. | 3390.6 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA |
Length | 30 |
4. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.