Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4757.5 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIICONH |
Length | 45 |
1. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Cationic cell-penetrating peptides are potent furin inhibitors
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.