Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
| M.W/Mr. | 4757.5 |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIICONH |
| Length | 45 |
2. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.