CAT# | C29001 |
M.W/Mr. | 4757.5 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIICONH |
Length | 45 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C29024 | Tyr-CRF (human, rat) | Inquiry | ||
C29017 | Tyr-CRF (ovine) | Inquiry | ||
C29019 | (D-Phe12,Nle21·38)-CRF (12-41) (human, rat) | Inquiry | ||
C29020 | (D-Phe12,Nle21·38,alpha-Me-Leu37)-CRF (12-41) (human, rat) | Inquiry | ||
C29016 | Corticotropin Releasing Factor, porcine | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...