Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C209H337N61O64S2 |
M.W/Mr. | 4792.6 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMENF-NH2 |
Length | 41 |
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.