CAT# | C29016 |
M.F/Formula | C209H337N61O64S2 |
M.W/Mr. | 4792.6 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMENF-NH2 |
Length | 41 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C29018 | ([13C6]Leu10)-CRF (human, rat) | Inquiry | ||
C29019 | (D-Phe12,Nle21·38)-CRF (12-41) (human, rat) | Inquiry | ||
C29002 | [Cys21] Corticotropin Releasing Factor, human, rat | Inquiry | ||
C29011 | α-Helical CRF (9-41) | Inquiry | ||
C29010 | Antisauvagine-30 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...
The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...