Corticotropin Releasing Factor, porcine

Corticotropin Releasing Factor, porcine is a neuroendocrine peptide used to investigate regulatory pathways controlling stress-related hormonal cascades. Its structure enables exploration of receptor-binding determinants. Researchers analyze its folding and motif accessibility. The peptide contributes to comparative studies across CRF family members.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C29016

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C209H337N61O64S2
M.W/Mr.
4792.6
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMENF-NH2
Length
41

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesPeptide CDMOCustom Conjugation ServicecGMP Peptide ServiceEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers