Obtustatin

Obtustatin is a highly potent and selective inhibitor of the binding of α1β1 integrin to collagen IV, however, does not show inhibitory activity toward other integrins, including α2β1, αIIbβ3, αvβ3, α4β1, α5β1, α6β1, and α9β1, α4β7 integrins. It displays antitumor efficacy.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Obtustatin

CAT No: R0985

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C184H284N52O57S8
M.W/Mr.
4393.07
Sequence
One Letter Code: CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(Disulfide bridge: Cys1 and Cys10, Cys6 and Cys29, Cys7 and Cys34, Cys19 and Cys36)
Biological Activity
Highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.
Long-term Storage Conditions
Soluble to 1 mg/ml in water
Shipping Condition
Room temperature in continental US; may vary elsewhere.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Modification ServicesPeptide CDMOPeptide Nucleic Acids SynthesisPeptide Analysis ServicesEpitope Mapping ServicesPeptide Synthesis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers