1-631-624-4882
info@creative-peptides.com

[Ala20]-beta-Amyloid (1-42)

Name: [Ala20]-beta-Amyloid (1-42)
Brand: Creative Peptides
SKU: A13291
Availability: MadeToOrder

[Ala20]-beta-Amyloid (1-42) is a modified form of the amyloid-beta peptide with an alanine substitution at position 20, affecting its aggregation properties. The peptide plays a central role in Alzheimer's disease by forming plaques in the brain. Researchers use this analog to study the effects of sequence modifications on amyloid aggregation, plaque formation, and toxicity in Alzheimer's research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A13291

Custom Peptide Synthesis

cGMP Peptide

Registration of APIs
CMC information required for an IND

IND and NDA support
Drug master files (DMF) filing

M.W/Mr.

4438

Sequence

DAEFRHDSGYEVHHQKLVFAAEDVGSNKGAIIGLMVGGVVIA

Length

1. Characterization of Novel P-Selectin Targeted Complement Inhibitors in Murine Models of Hindlimb Injury and Transplantation

2. Sex differences in oxidative stress level and antioxidative enzymes expression and activity in obese pre-diabetic elderly rats treated with metformin or liraglutide

3. Extended exenatide administration enhances lipid metabolism and exacerbates pancreatic injury in mice on a high fat, high carbohydrate diet

4. Immune responses to peptides containing homocitrulline or citrulline in the DR4-transgenic mouse model of rheumatoid arthritis

5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services

Epitope Mapping Services Peptide Analysis Services Custom Conjugation Service Peptide Modification Services Peptide Nucleic Acids Synthesis Peptide CDMO Peptide Synthesis Services cGMP Peptide Service

Hot Products

Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Alarelin acetate

Alarelin Acetate is a high-purity synthetic peptide used in fertility and ovulation research. Buy Alarelin peptide online from a trusted peptide supplier for advanced hormonal studies.

Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy