CAT# | AF2650 |
Sequence | KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW |
Activity | Antibacterial |
Host Chemicals | Leuconostoc gelidum | Length | 37 | SwissProt ID | P34034 , Q53446 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2649 | Bacteriocin mesentericin Y105 | Inquiry | ||
AF1029 | LSEI_2386 | Inquiry | ||
AF3316 | Pilosulin 1 | Inquiry | ||
AF2608 | Oxyopinin-2b | Inquiry | ||
AF085 | Temporin-K | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...