Home > Product > Antimicrobial Peptides > Bacteriocin leucocin-A precursor

Antimicrobial Peptides

Bacteriocin leucocin-A precursor

Price Inquiry
CAT#
AF2650
Sequence
KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
Host Chemicals
Leuconostoc gelidum
Length
37
Activity
Antibacterial
SwissProt ID
P34034 , Q53446

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.